PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_016939-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 196aa    MW: 22278.3 Da    PI: 10.3946
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_016939-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
  AHYPO_016939-RA 14 KGAWTKEEDDRLIAYIKVHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.55.5e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++Edel+++++ +lG++ W+ Ia ++  gRt++++k++w+++
  AHYPO_016939-RA  67 RGNFTEQEDELIIKLHSLLGNK-WSMIAGRLA-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.149961IPR017930Myb domain
SuperFamilySSF466893.59E-2913108IPR009057Homeodomain-like
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002493.1E-151461IPR001005SANT/Myb domain
CDDcd001676.74E-101661No hitNo description
PROSITE profilePS5129427.56162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2765116IPR009057Homeodomain-like
SMARTSM007175.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1467111IPR001005SANT/Myb domain
CDDcd001671.96E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGRSPCCEKS HTNKGAWTKE EDDRLIAYIK VHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEQEDELIIK LHSLLGNKWS MIAGRLAGRT DNEIKNYWNT HIKRKLLNKG  120
IDPLTHRPLN GNVSSHSDSS STTPNSTTTT ISFSTTKNPK KEQNQSSIPT KSRDYENRDK  180
DLFYLQFGVG KKSRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
1h8a_C4e-281311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012081759.11e-93PREDICTED: myb-related protein 308
RefseqXP_010431803.12e-93PREDICTED: transcription repressor MYB4-like
SwissprotQ9SZP11e-93MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A067K0951e-93A0A067K095_JATCU; MYB family protein
STRINGfgenesh2_kg.7__59__AT4G38620.17e-92(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-88myb domain protein 4